PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G044900.2
Common NameB456_007G044900, LOC105802132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 806aa    MW: 89886.7 Da    PI: 6.6667
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G044900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3733.7e-23163264199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++ +++a+e+      ++++++ ++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   
  Gorai.007G044900.2 163 FCKTLTASDTSTHGGFSVLRRHADEClppldmSLQPPT-QELVSKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKKLVAGDAFIFL-- 250
                         99*****************************9777666.49999*********************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+v+v+r+
  Gorai.007G044900.2 251 RGENGELRVGVRRA 264
                         449999*****985 PP

2Auxin_resp119.23.2e-39289371183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha +t+++F+v+Y+Pr+s++eF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rW++SkWr+Lk
  Gorai.007G044900.2 289 AWHAYTTRTIFTVYYKPRTSPAEFIVPFNQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPKRWQGSKWRCLK 371
                         79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.29E-39153292IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.2E-40158278IPR015300DNA-binding pseudobarrel domain
CDDcd100171.31E-20161263No hitNo description
PfamPF023623.6E-21163264IPR003340B3 DNA binding domain
SMARTSM010192.8E-21163265IPR003340B3 DNA binding domain
PROSITE profilePS5086311.646163265IPR003340B3 DNA binding domain
PfamPF065073.6E-36289371IPR010525Auxin response factor
PfamPF023098.5E-8729805IPR033389AUX/IAA domain
SuperFamilySSF542771.77E-9735805No hitNo description
PROSITE profilePS5174521.645737805IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 806 aa     Download sequence    Send to blast
MTTSEISIKG NCVNGRGDGF SSGYTEPRDT RNAMEGQNGH SARTAAVRET VDHERALYTE  60
LWHACAGPLV TVPRELERVF YFPQGHIEQV EASTHQVSEQ QMPVYDLPPK ILCRVINVQL  120
KAEPDTDEVF AQVTLLPEHN QDENMVDKEP PIHEPPRFQV HSFCKTLTAS DTSTHGGFSV  180
LRRHADECLP PLDMSLQPPT QELVSKDLHG NEWRFRHIFR GQPRRHLLQS GWSVFVSSKK  240
LVAGDAFIFL RGENGELRVG VRRALRQQGN VPSSVISSHS MHLGVLATAW HAYTTRTIFT  300
VYYKPRTSPA EFIVPFNQYM ESVKNNYSIG MRFKMRFEGE EAPEQRFTGT IVGIEDADPK  360
RWQGSKWRCL KVRWDETSTI PRPERVSPWK IEHALSPPAL NPLPMPRPKR PRTNAVSSSP  420
DSSVLSREGS SKVTVDPLPA SSFSRVLQGQ EFSTLRGTFA ESNDSDTADR SVMWPPSIDD  480
EKIDVAHGER KFGPENWMPS RRHEPTYTDL LSGFGSNADT SRGYYPSFVD QTSVAGNSGK  540
KQLLGQEGKL GSWSLLPSGL SLKLSDSSTD PPLQGSDVPY QARGNGRFSG FGDYPILEGH  600
RIECSRGNWL MPPPTTSCYD NSIHSRDLMP KTSLAQEHKN GKSREGNCKL FGIPLISTSS  660
ASEPAVSHIS AFAKPVGHMQ AALHQFHALE SDKRSENSNA SQMAEDVSAF NEQEKIVKLG  720
QPHAREFQSK LSTASTRSCT KVLMQGTALG RSVDLTKFNN YDELIAELDQ LFEFGGELMA  780
PQKNWLVVYT DDEGDMMLVG DDPWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1785639218353Auxin response factor 1
4ldw_A1e-1785639218353Auxin response factor 1
4ldw_B1e-1785639218353Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.19890.0flower| flowering
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489050.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A0D2S6W70.0A0A0D2S6W7_G
STRINGVIT_17s0000g00320.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]